Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 119 (Tas2r119)

This Recombinant Mouse Taste receptor type 2 member 119 (Tas2r119) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 119, T2R119, Taste receptor type 2 member 19, T2R19

UniProt

Q9JKT2

Expression Region

1-335

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMEGHMLFFLLVVVVQFLTGVLANGLIVVVNAIDLIMWKKMAPLDLLLFCLATSRIILQL CILFAQLGLSCLVRHTLFADNVTFVYIINELSLWFATWLGVFYCAKIATIPHPLFLWLKM RISRLVPWLILASVVYVTVTTFIHSRETSELPKQIFISFFSKNTTRVRPAHATLLSVFVF GLTLPFLIFTVAVLLLLSSLWNHSRQMRTMVGTREPSRHALVSAMLSILSFLILYLSHDM VAVLICTQGLHFGSRTFAFCLLVIGMYPSLHSIVLILGNPKLKRNAKTFIVHCKCCHCAR AWVTSRNPRLSDLPVPATHHSANKTSCSEACIMPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-100 1x 100 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF647 conjugate, 0.1mg/mL
BNC472981-500 1x 500 µL

Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF568 conjugate, 0.1mg/mL
BNC681865-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF488A conjugate, 0.1mg/mL
BNC881993-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details