Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-9 (srg-9)

This Recombinant Serpentine receptor class gamma-9 (srg-9) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-9, Protein srg-9

UniProt

P46566

Expression Region

1-336

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTNSTTPMSITDMECNPNYSYLVENIKYLLQAAYMVPPAFLYARILYVIWVKHRKVYSR HQFFVIYSMDSIVGFILLLLDIFITRFFVYVPQLCIPASKFFQSHSLLMNIYYPLLNYLH CAQPLIQIFLTLNRMSSVIWPVDHNKVWSKNLSFIVAFVSLSPFLIIWNTIISPKIIIYY FGGFFMLGLKAVEWADISLFLFLVRSVAVIITVASTVIMFLRMSKMKKRMKSSERTLCLA CVIHSICFMVPSFFEALANFNEAYGSSWVNFLIQPFAWDVLNVGSPLIMIFVSGQLRHHV LEISIGCCKPKNKPKTITVHTVTAHVSSRNGTSIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal QKI/Quaking Antibody (PCRP-QKI-2F10) [FITC]
NBP3-14072F 0.1 mL

Mouse Monoclonal QKI/Quaking Antibody (PCRP-QKI-2F10) [FITC]

Sign In for Pricing
View Details
CD19 Recombinant Rabbit mAb, Biotin conjugated
orb3126760 100 µL

CD19 Recombinant Rabbit mAb, Biotin conjugated

Sign In for Pricing
View Details
Goat anti Mouse IgM (Fab'2) (Texas Red)
43C-CJ0221 1 mg

Goat anti Mouse IgM (Fab'2) (Texas Red)

Sign In for Pricing
View Details
AKR7A3 Antibody
PT-A00166-01 5 µg

AKR7A3 Antibody

Sign In for Pricing
View Details
AKR7A3 Antibody
PT-A00166-02 20 µg

AKR7A3 Antibody

Sign In for Pricing
View Details
AKR7A3 Antibody
PT-A00166-03 100 µg

AKR7A3 Antibody

Sign In for Pricing
View Details