Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-9 (srg-9)

This Recombinant Serpentine receptor class gamma-9 (srg-9) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-9, Protein srg-9

UniProt

P46566

Expression Region

1-336

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTNSTTPMSITDMECNPNYSYLVENIKYLLQAAYMVPPAFLYARILYVIWVKHRKVYSR HQFFVIYSMDSIVGFILLLLDIFITRFFVYVPQLCIPASKFFQSHSLLMNIYYPLLNYLH CAQPLIQIFLTLNRMSSVIWPVDHNKVWSKNLSFIVAFVSLSPFLIIWNTIISPKIIIYY FGGFFMLGLKAVEWADISLFLFLVRSVAVIITVASTVIMFLRMSKMKKRMKSSERTLCLA CVIHSICFMVPSFFEALANFNEAYGSSWVNFLIQPFAWDVLNVGSPLIMIFVSGQLRHHV LEISIGCCKPKNKPKTITVHTVTAHVSSRNGTSIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALR siRNA (h)
sc-72224 10 µM

ALR siRNA (h)

Sign In for Pricing
View Details
LAPTM4A Polyclonal Antibody
A69899-050 50 μL

LAPTM4A Polyclonal Antibody

Sign In for Pricing
View Details
(5-Chloro-2,1,3-benzothiadiazol-4-yl) -cyanamide
sc-391997 10 mg

(5-Chloro-2,1,3-benzothiadiazol-4-yl) -cyanamide

Sign In for Pricing
View Details
OTUB2 (Ubiquitin Thioesterase OTUB2, Deubiquitinating Enzyme OTUB2, OTU Domain-containing Ubiquitin Aldehyde-binding Protein 2, Otubain-2, Ubiquitin-specific-processing Protease OTUB2, C14orf137, OTB2, OTU2, FLJ21916, MGC3102) (MaxLight 750) discontinued
130770-ML750 100 µL

OTUB2 (Ubiquitin Thioesterase OTUB2, Deubiquitinating Enzyme OTUB2, OTU Domain-containing Ubiquitin Aldehyde-binding Protein 2, Otubain-2, Ubiquitin-specific-processing Protease OTUB2, C14orf137, OTB2, OTU2, FLJ21916, MGC3102) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Human TRAILR4/TNFRSF10D Alexa Fluor 594 MAb (Clone 104918R)
FAB633RU-100UG 100 µg

Human TRAILR4/TNFRSF10D Alexa Fluor 594 MAb (Clone 104918R)

Sign In for Pricing
View Details
Phospho-PI3 kinase p85 alpha + gamma (Tyr467 + Tyr199) Polyclonal Antibody
bs-3332R-01 20 µL

Phospho-PI3 kinase p85 alpha + gamma (Tyr467 + Tyr199) Polyclonal Antibody

Sign In for Pricing
View Details