Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-9 (srg-9)

This Recombinant Serpentine receptor class gamma-9 (srg-9) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-9, Protein srg-9

UniProt

P46566

Expression Region

1-336

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTNSTTPMSITDMECNPNYSYLVENIKYLLQAAYMVPPAFLYARILYVIWVKHRKVYSR HQFFVIYSMDSIVGFILLLLDIFITRFFVYVPQLCIPASKFFQSHSLLMNIYYPLLNYLH CAQPLIQIFLTLNRMSSVIWPVDHNKVWSKNLSFIVAFVSLSPFLIIWNTIISPKIIIYY FGGFFMLGLKAVEWADISLFLFLVRSVAVIITVASTVIMFLRMSKMKKRMKSSERTLCLA CVIHSICFMVPSFFEALANFNEAYGSSWVNFLIQPFAWDVLNVGSPLIMIFVSGQLRHHV LEISIGCCKPKNKPKTITVHTVTAHVSSRNGTSIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound NP-000222
MBS5796066 Inquire

Compound NP-000222

Sign In for Pricing
View Details
Plumbemycin A
orb1740512-01 25 mg

Plumbemycin A

Sign In for Pricing
View Details
Plumbemycin A
orb1740512-02 50 mg

Plumbemycin A

Sign In for Pricing
View Details
Plumbemycin A
orb1740512-03 100 mg

Plumbemycin A

Sign In for Pricing
View Details
Ikaros (5T8) Rabbit Monoclonal Antibody
E28M2429 100 µL

Ikaros (5T8) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
1700020C07Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
10185114 3x 1.0 µg

1700020C07Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details