Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bifidobacterium adolescentis Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Bifidobacterium adolescentis Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A1A1J0

Expression Region

1-336

Origin

Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLAYIPSPTISQFSIGPVTIHFYALCILLGIVLAVWMTTVHWKRYGGNFDQILDITLVA VPSGIIGARIYHIITTPERFFGPTGDWVEMFRIWNGGLGIWGGVLLGALAAWAWCRHKHY PMALLGDAVAPGLLVAQAVGRLGNWFNQELYGAPTTLPWGLKLNMEGSAIGHSEQCYDGA TCPTGTLFHPTFLYEMIWNLIGAALIVFLGSKIMKKLKAGSLFAIYIMWYTVGRTWIEAL RIDFAHEFLGVRINVWVSMAVFVLGVVAFIVIQQMGKSTELLAEKLRTVTEIELSLVEDG ETGLPTAKANLTKTKDEITANDGSSVSYADDQSDNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-100 1x 100 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
BNC040181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
BNC471003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
BNC941820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details