Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-15 (srb-15)

This Recombinant Serpentine receptor class beta-15 (srb-15) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-15, Protein srb-15

UniProt

O01509

Expression Region

1-336

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEISEICETAFKLTYHPIYRGSLFIHLFVSISSIIPLIYFVIFKLPKTSFHGNLKFLFS AYFVSVFLFSVDFAIISTTEILIPLFSKHPCNLLIPDQYLKIGNTTVSIFMSLSTFFPIS ITIERFIAMKMARTYEKTRVRLGPILTGCNILLDLLIVFFIYRDEKFDDGSISFVFFPKT LAPKMFTFFWVMFFLNLINFTFNSYLLRQSIRLKVSTSSLATKYQREEVVHSTKFAVFVV FCHVILFGFYVIGIMILRYFGSIFIPDPADLMATRGAFTTMISLYNLVVGSVAVYLNHLI KTRKSEEITGTVRIQATGAVGAQNYENAIFNIWNSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EUK 124
MBS5757255 Inquire

EUK 124

Sign In for Pricing
View Details
Fam50b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6683405 3x 1.0 µg

Fam50b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
IQCC sgRNA CRISPR Lentivector set (Human)
K1095501 3x 1.0 µg

IQCC sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Ccr1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4447404 1.0 µg DNA

Ccr1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
ZDHHC20 Antibody
CSB-PA008523-01 50 µg

ZDHHC20 Antibody

Sign In for Pricing
View Details
ZDHHC20 Antibody
CSB-PA008523-02 100 µg

ZDHHC20 Antibody

Sign In for Pricing
View Details