Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-15 (srb-15)

This Recombinant Serpentine receptor class beta-15 (srb-15) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-15, Protein srb-15

UniProt

O01509

Expression Region

1-336

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEISEICETAFKLTYHPIYRGSLFIHLFVSISSIIPLIYFVIFKLPKTSFHGNLKFLFS AYFVSVFLFSVDFAIISTTEILIPLFSKHPCNLLIPDQYLKIGNTTVSIFMSLSTFFPIS ITIERFIAMKMARTYEKTRVRLGPILTGCNILLDLLIVFFIYRDEKFDDGSISFVFFPKT LAPKMFTFFWVMFFLNLINFTFNSYLLRQSIRLKVSTSSLATKYQREEVVHSTKFAVFVV FCHVILFGFYVIGIMILRYFGSIFIPDPADLMATRGAFTTMISLYNLVVGSVAVYLNHLI KTRKSEEITGTVRIQATGAVGAQNYENAIFNIWNSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFT46 Polyclonal Antibody, HRP Conjugated
bs-15563R-HRP 100 µL

IFT46 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Serum for BEL-7404 Cell Culture
C6113F-50ml 50 mL

Serum for BEL-7404 Cell Culture

Sign In for Pricing
View Details
CCNDBP1 Knockout HAP1 Polyclonal Cells
ARG43238 1 Million

CCNDBP1 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Bovine Gasdermin-A (GSDMA) ELISA Kit
EIA07473Bo 1 Kit

Bovine Gasdermin-A (GSDMA) ELISA Kit

Sign In for Pricing
View Details
AMMECR1L sgRNA CRISPR Lentivector set (Human)
K0081501 3x 1.0 µg

AMMECR1L sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant human EGF protein
EGF0501-050 50 µg

Recombinant human EGF protein

Sign In for Pricing
View Details