Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-15 (srb-15)

This Recombinant Serpentine receptor class beta-15 (srb-15) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-15, Protein srb-15

UniProt

O01509

Expression Region

1-336

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEISEICETAFKLTYHPIYRGSLFIHLFVSISSIIPLIYFVIFKLPKTSFHGNLKFLFS AYFVSVFLFSVDFAIISTTEILIPLFSKHPCNLLIPDQYLKIGNTTVSIFMSLSTFFPIS ITIERFIAMKMARTYEKTRVRLGPILTGCNILLDLLIVFFIYRDEKFDDGSISFVFFPKT LAPKMFTFFWVMFFLNLINFTFNSYLLRQSIRLKVSTSSLATKYQREEVVHSTKFAVFVV FCHVILFGFYVIGIMILRYFGSIFIPDPADLMATRGAFTTMISLYNLVVGSVAVYLNHLI KTRKSEEITGTVRIQATGAVGAQNYENAIFNIWNSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NAPRT antibody
STJ111476 100 µl

Anti-NAPRT antibody

Sign In for Pricing
View Details
BioWave Violet 450 Anti-Mouse CD4 (RM4-5)
orb1215005-01 25 µg

BioWave Violet 450 Anti-Mouse CD4 (RM4-5)

Sign In for Pricing
View Details
BioWave Violet 450 Anti-Mouse CD4 (RM4-5)
orb1215005-02 100 µg

BioWave Violet 450 Anti-Mouse CD4 (RM4-5)

Sign In for Pricing
View Details
Omega-3 fatty acid receptor 1
AP86077 1 mg

Omega-3 fatty acid receptor 1

Sign In for Pricing
View Details
Benzaldehyde, 3-fluoro-
orb1987266-01 100 mg

Benzaldehyde, 3-fluoro-

Sign In for Pricing
View Details
Benzaldehyde, 3-fluoro-
orb1987266-02 500 mg

Benzaldehyde, 3-fluoro-

Sign In for Pricing
View Details