Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-51 (srd-51)

This Recombinant Serpentine receptor class delta-51 (srd-51) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-51, Protein srd-51

UniProt

Q19473

Expression Region

1-336

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEVEKKLEMFVTVYYSLNVTLALSINILLLFIMKTTKSSLLKDMQYYLFNTALFEIIVS LSTYFAQCRPVANKSTLAVFCHGPCKYFGKNTCFVTFAVVQCSVVAASFSILLSFYYRYR LLKVNFKKKHKHATTFIIFSFFPTVMLLFQLLTDSNFAIVEAETREMHPDYDYVNNALIG FSDSKSPAAIIAQSLISLGVYMSPLIAFHYRRKINKILSTNTGQRIPVAYCKQLINGLLI QTLIPFCVYIPPYSYFLYSQLSGHSNLYFEYLLNIFGSFTAFINPLLTFYFVLPYRRALC KKVFKYFPSISEEGTEITTFPTTVQFQRGHTASTKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant alpha Smooth Muscle Actin Antibody
RC-6367-01 50 μL

Recombinant alpha Smooth Muscle Actin Antibody

Sign In for Pricing
View Details
Recombinant alpha Smooth Muscle Actin Antibody
RC-6367-02 100 µL

Recombinant alpha Smooth Muscle Actin Antibody

Sign In for Pricing
View Details
Recombinant alpha Smooth Muscle Actin Antibody
RC-6367-03 1 mL

Recombinant alpha Smooth Muscle Actin Antibody

Sign In for Pricing
View Details
CD45RO (UCHL1 + T200/797), 0.2mg/mL
BNUB1209-100 1x 100 µL

CD45RO (UCHL1 + T200/797), 0.2mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon
CB513926 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
NF-kB p65 (RELA) Rabbit Polyclonal Antibody
AP02556PU-N 100 µL

NF-kB p65 (RELA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details