Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-51 (srd-51)

This Recombinant Serpentine receptor class delta-51 (srd-51) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-51, Protein srd-51

UniProt

Q19473

Expression Region

1-336

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEVEKKLEMFVTVYYSLNVTLALSINILLLFIMKTTKSSLLKDMQYYLFNTALFEIIVS LSTYFAQCRPVANKSTLAVFCHGPCKYFGKNTCFVTFAVVQCSVVAASFSILLSFYYRYR LLKVNFKKKHKHATTFIIFSFFPTVMLLFQLLTDSNFAIVEAETREMHPDYDYVNNALIG FSDSKSPAAIIAQSLISLGVYMSPLIAFHYRRKINKILSTNTGQRIPVAYCKQLINGLLI QTLIPFCVYIPPYSYFLYSQLSGHSNLYFEYLLNIFGSFTAFINPLLTFYFVLPYRRALC KKVFKYFPSISEEGTEITTFPTTVQFQRGHTASTKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Extracellular Acidification Rate (ECAR) Fluorometric Assay Kit
E-BC-F069-01 48 Tests

Extracellular Acidification Rate (ECAR) Fluorometric Assay Kit

Sign In for Pricing
View Details
Extracellular Acidification Rate (ECAR) Fluorometric Assay Kit
E-BC-F069-02 96 Tests

Extracellular Acidification Rate (ECAR) Fluorometric Assay Kit

Sign In for Pricing
View Details
Recombinant Human OTUB1/OTB1 Protein (His Tag)
PKSH030767 100 µg

Recombinant Human OTUB1/OTB1 Protein (His Tag)

Sign In for Pricing
View Details
PSAP Polyclonal Antibody
AN006050L-01 25 µL

PSAP Polyclonal Antibody

Sign In for Pricing
View Details
PSAP Polyclonal Antibody
AN006050L-02 100 µL

PSAP Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS504935 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details