Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat P2Y purinoceptor 13 (P2ry13)

This Recombinant Rat P2Y purinoceptor 13 (P2ry13) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

P2Y purinoceptor 13, P2Y13

UniProt

Q6GUG4

Expression Region

1-336

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLGTVNTTGMQGFNKSERCPRDTRMTQLLFPVLYTVVFFTGVLLNTLALWVFIHIPSNST FIIYLKNTLVADLIMTLMLPFKILSDSRLAPWQLRGFVCTFSSVVFYETMYVGIMMLGLI AFDRFLKIVVPFRKTFVKKTAFAKIVSISIWLLMFLISLPNMILNKEATASTVKKCASLK SPLGLLWHQVVSHTCQFIFWTVFILMLLFYTVIAKKVYDSYRKFKSRDSKHKRLEAKVFI VMAVFFVCFAPFHFVRVPYTHSQTTNKTDCRLENQLFLAKESTLFLATTNICMDPLIYII LCKKFTRKVPCMRWRTKTAASSDEHHSSQTDNITLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-100 1x 100 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-100 1x 100 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
BNC940009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL
BNC140146-500 1x 500 µL

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details