Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saguinus imperator Duffy antigen/chemokine receptor (DARC)

This Recombinant Saguinus imperator Duffy antigen/chemokine receptor (DARC) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Duffy antigen/chemokine receptor, CD_antigen= CD234

UniProt

Q95LF7

Expression Region

1-336

Origin

Saguinus imperator (Emperor tamarin)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNCLHQAELSPSTENSSQLNLEDLWNFSYDGNDSFPEIDYDASLEAAAPCHSCNLLDDS SLPFFILASVLGILASSTVLFLLFRPLFRWQLCPGWPVLAQLAVGSTLFSIVVPILAPGL GNTRSSAPCSLGYCVWYGSAFAQALLLGCHASLGPKLGAGQVPGLTLGLSVGLWGAAALL TLPITLASDASDGLCTPIYSTELKALQATHTVACFAIFVLLPLGLFGAKGLKKVLGMGPG PWMNILWVWFIFWWPHGVVLGLDFLVRSKLLLLPTCLAQQVLDLLLNLAEALAIVHCVAT PLLLALFCHQATRTLVPSLPLPERWSSPVDTLGSKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-500 1x 500 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF740 conjugate, 0.1mg/mL
BNC741482-100 1x 100 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/903), CF488A conjugate, 0.1mg/mL
BNC880903-100 1x 100 µL

Cytokeratin 7 (KRT7/903), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (rB22.1), CF640R conjugate, 0.1mg/mL
BNC402175-100 1x 100 µL

Cytokeratin 8 (KRT8) (rB22.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF647 conjugate, 0.1mg/mL
BNC472488-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (NR-4), CF647 conjugate, 0.1mg/mL
BNC470303-100 1x 100 µL

Neurofilament (NF-L) (NR-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details