Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carassius auratus Ultraviolet-sensitive opsin

This Recombinant Carassius auratus Ultraviolet-sensitive opsin spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Ultraviolet-sensitive opsin, Ultraviolet cone photoreceptor pigment

UniProt

Q90309

Expression Region

1-336

Origin

Carassius auratus (Goldfish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAWTYQFGNLSKISPFEGPQYHLAPKWAFYLQAAFMGFVFFVGTPLNAIVLFVTMKYKK LRQPLNYILVNISLGGFIFDTFSVSQVFFSALRGYYFFGYTLCAMEAAMGSIAGLVTGWS LAVLAFERYVVICKPFGSFKFGQSQALGAVALTWIIGIGCATPPFWGWSRYIPEGIGTAC GPDWYTKNEEYNTESYTYFLLVSCFMMPIMIITFSYSQLLGALRAVAAQQAESASTQKAE KEVSRMVVVMVGSFVVCYGPYAITALYFSYAEDSNKDYRLVAIPSLFSKSSCVYNPLIYA FMNKQFNACIMETVFGKKIDESSEVSSKTETSSVSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS72 Over-expression Lysate Product
GWB-B13966 0.1 mg

VPS72 Over-expression Lysate Product

Sign In for Pricing
View Details
Human OR1F1 Pre-designed siRNA Set B
SI011162B 1 Each

Human OR1F1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Protein Zero, Myelin (MPZ)
MBS2050375-01 0.1 mL

HRP-Linked Polyclonal Antibody to Protein Zero, Myelin (MPZ)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Protein Zero, Myelin (MPZ)
MBS2050375-02 0.2 mL

HRP-Linked Polyclonal Antibody to Protein Zero, Myelin (MPZ)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Protein Zero, Myelin (MPZ)
MBS2050375-03 0.5 mL

HRP-Linked Polyclonal Antibody to Protein Zero, Myelin (MPZ)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Protein Zero, Myelin (MPZ)
MBS2050375-04 1 mL

HRP-Linked Polyclonal Antibody to Protein Zero, Myelin (MPZ)

Sign In for Pricing
View Details