Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Neuropeptides B/W receptor type 2 (NPBWR2)

This Recombinant Bovine Neuropeptides B/W receptor type 2 (NPBWR2) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Neuropeptides B/W receptor type 2, G-protein coupled receptor 8

UniProt

Q8MJV2

Expression Region

1-336

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMEATGLEGLESTSSPCPGSTGTGLSWDNGTRHNATFPEPLPALYVLLPVVYSVICAVGL VGNAAVICVILRAPKMKTVTHVFILNLAIADGLFTLVLPTNIAEHLLQRWPFGEVLCKLV LAIDHCNIFSSVYFLAAMSIDRYLVVLATARSRRMPRRTVHRAKVASLCVWLGVTVAVLP FLTFAGVYNNELQVTSCGLSFPRPERAWFQASRIYTLVLGFVVPMCTLCVLYADLLRRLR ALRLHSGAKALGKAKRKVSLLVLAVLAVGLLCWTPFHLASIVALTTDLPQTPLVIIVSYV VTSLSYTSSCLNPFLYAFLDHSFRKSLRTACRCQGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-100 1x 100 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-500 1x 500 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
BNC400149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (SOX10/2311R), CF740 conjugate, 0.1mg/mL
BNC742311-500 1x 500 µL

SOX10 (Melanoma Marker) (SOX10/2311R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UACA / Nucling (AE-5), CF488A conjugate, 0.1mg/mL
BNC880956-100 1x 100 µL

UACA / Nucling (AE-5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (rKLC709), CF405S conjugate, 0.1mg/mL
BNC042050-500 1x 500 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (rKLC709), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details