Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-6 (srb-6)

This Recombinant Serpentine receptor class beta-6 (srb-6) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-6, Protein srb-6

UniProt

P54141

Expression Region

1-337

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDCDEVNNISYDPLYRYSQFYTLLTSIFSVFPLLYLIIFKLRVCTFNDNIKFLYIVYFT QILISVLNNCVVFAHHVVIPFLAVSKCDLLVNPVKNRIFQNIGVFGISCPMLTILGITAE RLLALIFARCYENVKLHIGVFIGVFAMLCDMALVYFFFLDEKFDQPSISYFMVPDTSGYK MNWLCYSLLAINSVNLVFNYFLVKINTILKEKWRNSLSTRYQMEENIITTKFSTFISFIH VFFFSLYLIFTLIIRLLGPGFLKTQADLMSVRGVYITIPTYNLIIGIASCVILRHLQRQK VAKVYAEVTLKYSGIDGAQIHQEAILNVWKTKSSGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TRIM43 siRNA
abx938071-01 15 nmol

Human TRIM43 siRNA

Sign In for Pricing
View Details
Human TRIM43 siRNA
abx938071-02 30 nmol

Human TRIM43 siRNA

Sign In for Pricing
View Details
TRF2 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61777R-BF647-01 20 µL

TRF2 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
TRF2 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61777R-BF647-02 100 µL

TRF2 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Sheep Tumor Necrosis Factor Alpha (TNFa) ELISA Kit
MBS456530-01 48 Tests

Sheep Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

Sign In for Pricing
View Details
Sheep Tumor Necrosis Factor Alpha (TNFa) ELISA Kit
MBS456530-02 96 Tests

Sheep Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

Sign In for Pricing
View Details