Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Psychosine receptor (Gpr65)

This Recombinant Mouse Psychosine receptor (Gpr65) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Psychosine receptor, G-protein coupled receptor 65, T-cell death-associated gene 8 protein

UniProt

Q61038

Expression Region

1-337

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMNSMCIEEQHHLEHYLFPVVYIIVFIVSVPANIGSLCVSFLQAKKENELGIYLFSLSL SDLLYALTLPLWINYTWNKDNWTFSPTLCKGSVFFTYMNFYSSTAFLTCIALDRYLAVVY PLKFSFLRTRRFAFITSLSIWILESFFNSMLLWKDETSVEYCDSDKSNFTLCYDKYPLEK WQINLNLFRTCMGYAIPLITIMICNHKVYRAVRHNQATENSEKRRIIKLLASITLTFVLC FTPFHVMVLIRCVLERDMNVNDKSGWQTFTVYRVTVALTSLNCVADPILYCFVTETGRAD MWNILKLCTRKHNRHQGQKRDILSVSTRDAVELEIID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human VSIR/VISTA Protein, C-His
EHK06901 100 μg

Recombinant Human VSIR/VISTA Protein, C-His

Sign In for Pricing
View Details
IL4 Matched Antibody Pair Set [ABP-S-052002]
ABP-S-052002 5 Plates

IL4 Matched Antibody Pair Set [ABP-S-052002]

Sign In for Pricing
View Details
Rat Protein Phosphatase 5 Catalytic Subunit (PPP5C) ELISA Kit
abx539812 96 Tests

Rat Protein Phosphatase 5 Catalytic Subunit (PPP5C) ELISA Kit

Sign In for Pricing
View Details
WARS2-IT1 Protein Vector (Human) (pPM-C-HA)
50253021 500 ng

WARS2-IT1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
NXF3 Antibody
29-438 100 µL

NXF3 Antibody

Sign In for Pricing
View Details
Guinea Pig Calcium activated chloride channel regulator 4 (CLCA4) ELISA Kit
GTR10340909 96 Well

Guinea Pig Calcium activated chloride channel regulator 4 (CLCA4) ELISA Kit

Sign In for Pricing
View Details