Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Psychosine receptor (Gpr65)

This Recombinant Mouse Psychosine receptor (Gpr65) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Psychosine receptor, G-protein coupled receptor 65, T-cell death-associated gene 8 protein

UniProt

Q61038

Expression Region

1-337

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMNSMCIEEQHHLEHYLFPVVYIIVFIVSVPANIGSLCVSFLQAKKENELGIYLFSLSL SDLLYALTLPLWINYTWNKDNWTFSPTLCKGSVFFTYMNFYSSTAFLTCIALDRYLAVVY PLKFSFLRTRRFAFITSLSIWILESFFNSMLLWKDETSVEYCDSDKSNFTLCYDKYPLEK WQINLNLFRTCMGYAIPLITIMICNHKVYRAVRHNQATENSEKRRIIKLLASITLTFVLC FTPFHVMVLIRCVLERDMNVNDKSGWQTFTVYRVTVALTSLNCVADPILYCFVTETGRAD MWNILKLCTRKHNRHQGQKRDILSVSTRDAVELEIID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CaMKII alpha/CAMK2A Antibody Picoband® (Dylight594 Conjugate)
A03241-1-Dylight594 100 µg

Anti-CaMKII alpha/CAMK2A Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
Iron Sulphite Agar Modified
M1852I-500G 500 g

Iron Sulphite Agar Modified

Sign In for Pricing
View Details
Human Transcription factor HES-2, HES2 ELISA KIT
ELI-27161h 96 Tests

Human Transcription factor HES-2, HES2 ELISA KIT

Sign In for Pricing
View Details
IFI30 siRNA (Mouse)
orb1842904-01 15 nmol

IFI30 siRNA (Mouse)

Sign In for Pricing
View Details
IFI30 siRNA (Mouse)
orb1842904-02 30 nmol

IFI30 siRNA (Mouse)

Sign In for Pricing
View Details
ATP5L Antibody
CSB-PA002374GA01HU 100 µL

ATP5L Antibody

Sign In for Pricing
View Details