Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 2-oxoglutarate receptor 1 (Oxgr1)

This Recombinant Mouse 2-oxoglutarate receptor 1 (Oxgr1) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

2-oxoglutarate receptor 1, Alpha-ketoglutarate receptor 1, G-protein coupled receptor 99

UniProt

Q6IYF8

Expression Region

1-337

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIEPLDSPASDSDFLDYPSALGNCTDEQISFKMQYLPVIYSIIFLVGFPGNTVAISIYIF KMRPWRGSTVIMLNLALTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFGFHFNLYSS ILFLTCFSLFRYVVIIHPMSCFSIQKTRWAVVACAGVWVISLVAVMPMTFLITSTTRTNR SACLDLTSSDDLTTIKWYNLILTATTFCLPLVIVTLCYTTIISTLTHGPRTHSCFKQKAR RLTILLLLVFYICFLPFHILRVIRIESRLLSISCSIESHIHEAYIVSRPLAALNTFGNLL LYVVVSNNFQQAFCSIVRCKASGDLEQGKKDSCSNNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Top3b Mouse Gene Knockout Kit (CRISPR)
KN518062 1 Kit

Top3b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RFC4 (NM_002916) Human Over-expression Lysate
LY419019 100 µg

RFC4 (NM_002916) Human Over-expression Lysate

Sign In for Pricing
View Details
SPATIAL (TBATA) Human Gene Knockout Kit (CRISPR)
KN416613 1 Kit

SPATIAL (TBATA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uncoated Porcine IL-6 (Interleukin 6) ELISA Kit
E-UNEL-P0010-01 5x 96 Tests

Uncoated Porcine IL-6 (Interleukin 6) ELISA Kit

Sign In for Pricing
View Details
Uncoated Porcine IL-6 (Interleukin 6) ELISA Kit
E-UNEL-P0010-02 15x 96 Tests

Uncoated Porcine IL-6 (Interleukin 6) ELISA Kit

Sign In for Pricing
View Details
ACOX1 Mouse Monoclonal Antibody [Clone ID: 153CT43.1.1]
AM33416PU-N 400 µL

ACOX1 Mouse Monoclonal Antibody [Clone ID: 153CT43.1.1]

Sign In for Pricing
View Details