Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 2-oxoglutarate receptor 1 (Oxgr1)

This Recombinant Mouse 2-oxoglutarate receptor 1 (Oxgr1) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

2-oxoglutarate receptor 1, Alpha-ketoglutarate receptor 1, G-protein coupled receptor 99

UniProt

Q6IYF8

Expression Region

1-337

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIEPLDSPASDSDFLDYPSALGNCTDEQISFKMQYLPVIYSIIFLVGFPGNTVAISIYIF KMRPWRGSTVIMLNLALTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFGFHFNLYSS ILFLTCFSLFRYVVIIHPMSCFSIQKTRWAVVACAGVWVISLVAVMPMTFLITSTTRTNR SACLDLTSSDDLTTIKWYNLILTATTFCLPLVIVTLCYTTIISTLTHGPRTHSCFKQKAR RLTILLLLVFYICFLPFHILRVIRIESRLLSISCSIESHIHEAYIVSRPLAALNTFGNLL LYVVVSNNFQQAFCSIVRCKASGDLEQGKKDSCSNNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FNDC1 activation kit by CRISPRa
GA113612 1 Kit

Human FNDC1 activation kit by CRISPRa

Sign In for Pricing
View Details
CLDND1 Human Gene Knockout Kit (CRISPR)
KN401014 1 Kit

CLDND1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EIF4E Rabbit Polyclonal Antibody
AP01512PU-N 100 µg

EIF4E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Anti-PHA-L Antibody
AAL-1801-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Anti-PHA-L Antibody

Sign In for Pricing
View Details
Integrin alpha-L Antibody
KC-3936-01 50 μL

Integrin alpha-L Antibody

Sign In for Pricing
View Details
Integrin alpha-L Antibody
KC-3936-02 100 µL

Integrin alpha-L Antibody

Sign In for Pricing
View Details