Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 26 (Gpr26)

This Recombinant Mouse G-protein coupled receptor 26 (Gpr26) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

G-protein coupled receptor 26

UniProt

Q8BZA7

Expression Region

1-337

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSWDAGLAGLLVGTIGVSLLSNGLVLLCLLHSADIRRQAPALFTLNLTCGNLLCTVVNM PLTLAGVVAQRQPAGDRLCRLAAFLDTFLAANSMLSMAALSIDRWVAVVFPLSYRAKMRL RDAAFMVAYTWLHALTFPATALALSWLGFHQLYASCTLCSRRPDERLRFAVFTSAFHALS FLLSFIVLCFTYLKVLKVARFHCKRIDVITMQTLVLLVDIHPSVRERCLEEQKRRRQRAT KKISTFIGTFLVCFAPYVITRLVELFSTAPIGSHWGVLSKCLAYSKAASDPFVYSLLRHQ YRRSCKELLNRIFNRRSLHSVGLTGDSHSQNILPVSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cytochrome P450 2C19 (CYP2C19) ELISA Kit
RD-CYP2C19-Ra-48Tests 48 Tests

Rat Cytochrome P450 2C19 (CYP2C19) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Lce3e shRNA (UAS) - Lentiviral mouse Lce3e shRNA (UAS) (25)
GTR15293009 1 Vial

Lentiviral mouse Lce3e shRNA (UAS) - Lentiviral mouse Lce3e shRNA (UAS) (25)

Sign In for Pricing
View Details
Transferrin (TF) Porcine ELISA Kit
H7590 96 Tests

Transferrin (TF) Porcine ELISA Kit

Sign In for Pricing
View Details
Aquaporin 4 Antibody
18-850 100 µL

Aquaporin 4 Antibody

Sign In for Pricing
View Details
RCC1 (Regulator of Chromosome Condensation, Chromosome Condensation Protein 1, Cell Cycle Regulatory Protein, RCC1, CHC1) (Biotin)
MBS6392223-01 0.1 mL

RCC1 (Regulator of Chromosome Condensation, Chromosome Condensation Protein 1, Cell Cycle Regulatory Protein, RCC1, CHC1) (Biotin)

Sign In for Pricing
View Details
RCC1 (Regulator of Chromosome Condensation, Chromosome Condensation Protein 1, Cell Cycle Regulatory Protein, RCC1, CHC1) (Biotin)
MBS6392223-02 5x 0.1 mL

RCC1 (Regulator of Chromosome Condensation, Chromosome Condensation Protein 1, Cell Cycle Regulatory Protein, RCC1, CHC1) (Biotin)

Sign In for Pricing
View Details