Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1F12 (OR1F12)

This Recombinant Human Olfactory receptor 1F12 (OR1F12) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Olfactory receptor 1F12, Hs6M1-35P

UniProt

Q8NHA8

Expression Region

1-337

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGKNQTNISEFLLLGFSSWQQQQVLLFALFLCLYLTGLFGNLLILLAIGSDHCLHTPMY FFLANLSLVDLCLPSATVPKMLLNIQTQTQTISYPGCLAQMYFCMMFANMDNFLLTVMAY DRYVAICHPLHYSTIMALRLCASLVAAPWVIAILNPLLHTLMMAHLHFCSDNVIHHFFCD INSLLPLSCSDTSLNQLSVLATVGLIFVVPSVCILVSYILIVSAVMKVPSAQGKLKAFST CGSHLALVILFYGAITGVYMSPLSNHSTEKDSAASVIFMVVAPVLNPFIYSLRNNELKGT LKKTLSRPGAVAHACNPSTLGGRGGWIMRSGDRDHPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Hydroxy-3-nitrobenzoic acid
TRC-H950843-500MG 500 mg

4-Hydroxy-3-nitrobenzoic acid

Sign In for Pricing
View Details
Mouse Tmub2 activation kit by CRISPRa
GA209077 1 Kit

Mouse Tmub2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human X-Ray Repair Cross Complementing 5 (XRCC5) ELISA Kit
RD-XRCC5-Hu-01 96 Tests

Human X-Ray Repair Cross Complementing 5 (XRCC5) ELISA Kit

Sign In for Pricing
View Details
Human X-Ray Repair Cross Complementing 5 (XRCC5) ELISA Kit
RD-XRCC5-Hu-02 48 Tests

Human X-Ray Repair Cross Complementing 5 (XRCC5) ELISA Kit

Sign In for Pricing
View Details
FKBP10 Human Gene Knockout Kit (CRISPR)
KN203676 1 Kit

FKBP10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prmt2 Mouse Gene Knockout Kit (CRISPR)
KN513935 1 Kit

Prmt2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details