Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1F12 (OR1F12)

This Recombinant Human Olfactory receptor 1F12 (OR1F12) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Olfactory receptor 1F12, Hs6M1-35P

UniProt

Q8NHA8

Expression Region

1-337

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGKNQTNISEFLLLGFSSWQQQQVLLFALFLCLYLTGLFGNLLILLAIGSDHCLHTPMY FFLANLSLVDLCLPSATVPKMLLNIQTQTQTISYPGCLAQMYFCMMFANMDNFLLTVMAY DRYVAICHPLHYSTIMALRLCASLVAAPWVIAILNPLLHTLMMAHLHFCSDNVIHHFFCD INSLLPLSCSDTSLNQLSVLATVGLIFVVPSVCILVSYILIVSAVMKVPSAQGKLKAFST CGSHLALVILFYGAITGVYMSPLSNHSTEKDSAASVIFMVVAPVLNPFIYSLRNNELKGT LKKTLSRPGAVAHACNPSTLGGRGGWIMRSGDRDHPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A (CHGA/777), CF405S conjugate, 0.1mg/mL
BNC040777-100 1x 100 µL

Chromogranin A (CHGA/777), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DUT Rabbit Polyclonal Antibody
AP23256PU-N 100 µg

DUT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL) Mouse Monoclonal Antibody [Clone ID: 2F4]
AM06737PU-N 100 µg

Alkaline Phosphatase (ALPL) Mouse Monoclonal Antibody [Clone ID: 2F4]

Sign In for Pricing
View Details
GAP43 Antibody
KC-508-01 50 μL

GAP43 Antibody

Sign In for Pricing
View Details
GAP43 Antibody
KC-508-02 100 µL

GAP43 Antibody

Sign In for Pricing
View Details
GAP43 Antibody
KC-508-03 1 mL

GAP43 Antibody

Sign In for Pricing
View Details