Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Visual pigment-like receptor peropsin (RRH)

This Recombinant Human Visual pigment-like receptor peropsin (RRH) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Visual pigment-like receptor peropsin

UniProt

O14718

Expression Region

1-337

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRNNLGNSSDSKNEDGSVFSQTEHNIVATYLIMAGMISIISNIIVLGIFIKYKELRTPT NAIIINLAVTDIGVSSIGYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVA VDRYLTICLPDVGRRMTTNTYIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWR KNDRSFVSYTMTVIAINFIVPLTVMFYCYYHVTLSIKHHTTSDCTESLNRDWSDQIDVTK MSVIMICMFLVAWSPYSIVCLWASFGDPKKIPPPMAIIAPLFAKSSTFYNPCIYVVANKK FRRAMLAMFKCQTHQTMPVTSILPMDVSQNPLASGRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGST2 antibody
70R-1664 100 µL

MGST2 antibody

Sign In for Pricing
View Details
1- (2,4-Dichloropyridin-3-yl) ethanone
WZB34989 2.5 g

1- (2,4-Dichloropyridin-3-yl) ethanone

Sign In for Pricing
View Details
TR C2 malemide
sc-481984 5 mg

TR C2 malemide

Sign In for Pricing
View Details
Ncf4 Mouse shRNA Plasmid (Locus ID 17972)
TR501440 1 Kit

Ncf4 Mouse shRNA Plasmid (Locus ID 17972)

Sign In for Pricing
View Details
Recombinant Entericidin A (ecnA)
MBS1193078-01 0.05 mg (E-Coli)

Recombinant Entericidin A (ecnA)

Sign In for Pricing
View Details
Recombinant Entericidin A (ecnA)
MBS1193078-02 0.2 mg (E-Coli)

Recombinant Entericidin A (ecnA)

Sign In for Pricing
View Details