Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Visual pigment-like receptor peropsin (RRH)

This Recombinant Human Visual pigment-like receptor peropsin (RRH) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Visual pigment-like receptor peropsin

UniProt

O14718

Expression Region

1-337

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRNNLGNSSDSKNEDGSVFSQTEHNIVATYLIMAGMISIISNIIVLGIFIKYKELRTPT NAIIINLAVTDIGVSSIGYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVA VDRYLTICLPDVGRRMTTNTYIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWR KNDRSFVSYTMTVIAINFIVPLTVMFYCYYHVTLSIKHHTTSDCTESLNRDWSDQIDVTK MSVIMICMFLVAWSPYSIVCLWASFGDPKKIPPPMAIIAPLFAKSSTFYNPCIYVVANKK FRRAMLAMFKCQTHQTMPVTSILPMDVSQNPLASGRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (2-Fluorophenyl) pyrrolidin-3-amine
WTB83633-01 50 mg

1- (2-Fluorophenyl) pyrrolidin-3-amine

Sign In for Pricing
View Details
1- (2-Fluorophenyl) pyrrolidin-3-amine
WTB83633-02 0.5 g

1- (2-Fluorophenyl) pyrrolidin-3-amine

Sign In for Pricing
View Details
MAK (male germ Cell-Associated Kinase, dJ417M14.2) (AP) discontinued
248415-AP 100 µL

MAK (male germ Cell-Associated Kinase, dJ417M14.2) (AP) discontinued

Sign In for Pricing
View Details
Donkey Intrinsic Factor Antibody IgG (IF-IgG) ELISA Kit
MBS9940961 Inquire

Donkey Intrinsic Factor Antibody IgG (IF-IgG) ELISA Kit

Sign In for Pricing
View Details
PARK7 Rabbit Polyclonal Antibody
54569-01 50 µL

PARK7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PARK7 Rabbit Polyclonal Antibody
54569-02 100 µL

PARK7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details