Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Visual pigment-like receptor peropsin (Rrh)

This Recombinant Mouse Visual pigment-like receptor peropsin (Rrh) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Visual pigment-like receptor peropsin

UniProt

O35214

Expression Region

1-337

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSEASDFNSSGSRSEGSVFSRTEHSVIAAYLIVAGITSILSNVVVLGIFIKYKELRTPT NAVIINLAFTDIGVSSIGYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVA MDRYLTISCPDVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWR NNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYAASDCTAHLHRDWADQADVTK MSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKK FRKAMLAMFKCQPHLAVPEPSTLPMDMPQSSLAPVRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EASYStep Pro Mouse Progesterone (Pg) ELISA Kit
RDEp-Pg-Mu 96 Tests

EASYStep Pro Mouse Progesterone (Pg) ELISA Kit

Sign In for Pricing
View Details
Snx12 Mouse Gene Knockout Kit (CRISPR)
KN516424 1 Kit

Snx12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cycloxygenase-2 (COX-2) (COX2/1941), Biotin conjugate, 0.1mg/mL
BNCB2377-500 1x 500 µL

Cycloxygenase-2 (COX-2) (COX2/1941), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF622 (NM_033414) Human Over-expression Lysate
LY403248 100 µg

ZNF622 (NM_033414) Human Over-expression Lysate

Sign In for Pricing
View Details
Poly-L-lysine Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
MGB12F2-LYS-L 10x 96 Well Plates

Poly-L-lysine Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS

Sign In for Pricing
View Details
Human PDCL3 activation kit by CRISPRa
GA112323 1 Kit

Human PDCL3 activation kit by CRISPRa

Sign In for Pricing
View Details