Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Visual pigment-like receptor peropsin (Rrh)

This Recombinant Mouse Visual pigment-like receptor peropsin (Rrh) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Visual pigment-like receptor peropsin

UniProt

O35214

Expression Region

1-337

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSEASDFNSSGSRSEGSVFSRTEHSVIAAYLIVAGITSILSNVVVLGIFIKYKELRTPT NAVIINLAFTDIGVSSIGYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVA MDRYLTISCPDVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWR NNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYAASDCTAHLHRDWADQADVTK MSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKK FRKAMLAMFKCQPHLAVPEPSTLPMDMPQSSLAPVRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Human Immunoglobulins
AAF-006-1 1 mL

Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Human Immunoglobulins

Sign In for Pricing
View Details
FAM149B1 (NM_173348) Human Over-expression Lysate
LC430400 20 µg

FAM149B1 (NM_173348) Human Over-expression Lysate

Sign In for Pricing
View Details
2,2,2-Trifluoro-1-(3-hydroxypiperidin-1-yl)ethan-1-one (>90%)
TRC-T206786-500MG 500 mg

2,2,2-Trifluoro-1-(3-hydroxypiperidin-1-yl)ethan-1-one (>90%)

Sign In for Pricing
View Details
(Fmoc-Cys-OSu)2
TRC-F657730-500MG 500 mg

(Fmoc-Cys-OSu)2

Sign In for Pricing
View Details
Tissue Total RNA, Testis
CR561663 5 µg

Tissue Total RNA, Testis

Sign In for Pricing
View Details
Recombinant CD1C Antibody
RC-16320-01 50 μL

Recombinant CD1C Antibody

Sign In for Pricing
View Details