Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Visual pigment-like receptor peropsin (Rrh)

This Recombinant Mouse Visual pigment-like receptor peropsin (Rrh) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Visual pigment-like receptor peropsin

UniProt

O35214

Expression Region

1-337

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSEASDFNSSGSRSEGSVFSRTEHSVIAAYLIVAGITSILSNVVVLGIFIKYKELRTPT NAVIINLAFTDIGVSSIGYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVA MDRYLTISCPDVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWR NNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYAASDCTAHLHRDWADQADVTK MSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKK FRKAMLAMFKCQPHLAVPEPSTLPMDMPQSSLAPVRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyanoacetic Acid
TRC-C987485-25G 25 g

Cyanoacetic Acid

Sign In for Pricing
View Details
Human SLC39A10 activation kit by CRISPRa
GA111431 1 Kit

Human SLC39A10 activation kit by CRISPRa

Sign In for Pricing
View Details
Isopropyl Myristate
TRC-I872905-25G 25 g

Isopropyl Myristate

Sign In for Pricing
View Details
FLCN (NM_144997) Human Recombinant Protein
TP320396 20 µg

FLCN (NM_144997) Human Recombinant Protein

Sign In for Pricing
View Details
EIF2A (NM_032025) Human Recombinant Protein
TP304303 20 µg

EIF2A (NM_032025) Human Recombinant Protein

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2959), CF568 conjugate, 0.1mg/mL
BNC682959-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2959), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details