Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proteinase-activated receptor 4 (F2rl3)

This Recombinant Mouse Proteinase-activated receptor 4 (F2rl3) spans the amino acid sequence from region 60-396.

Product Specifications

Product Name Alternative

Proteinase-activated receptor 4, PAR-4, Coagulation factor II receptor-like 3, Thrombin receptor-like 3

UniProt

O88634

Expression Region

60-396

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GYPGKFCANDSDTLELPASSQALLLGWVPTRLVPALYGLVVAVGLPANGLALWVLATRVP RLPSTILLMNLAVADLLLALVLPPRLAYHLRGQRWPFGEAACRVATAALYGHMYGSVLLL AAVSLDRYLALVHPLRARALRGQRLTTGLCLVAWLSAATLALPLTLHRQTFRLAGSDRML CHDALPLTEQTSHWRPAFICLAVLGCFVPLLAMGLCYGATLRALAANGQRYSHALRLTAL VLFSAVASFTPSNVLLVLHYSNPSPEAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSHEF REKVRAMLCRQPEASSSSQASREAGSRGTAICSSTLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human LATS2 pAb
PA9939-01 50 μL

Rabbit Anti-Human LATS2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human LATS2 pAb
PA9939-02 100 μL

Rabbit Anti-Human LATS2 pAb

Sign In for Pricing
View Details
Rat DRD4 siRNA
abx914625-01 15 nmol

Rat DRD4 siRNA

Sign In for Pricing
View Details
Rat DRD4 siRNA
abx914625-02 30 nmol

Rat DRD4 siRNA

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ankyrin 1, Erythrocytic (ANK1)
MBS2057321-01 0.1 mL

PE-Linked Polyclonal Antibody to Ankyrin 1, Erythrocytic (ANK1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ankyrin 1, Erythrocytic (ANK1)
MBS2057321-02 0.2 mL

PE-Linked Polyclonal Antibody to Ankyrin 1, Erythrocytic (ANK1)

Sign In for Pricing
View Details