Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proteinase-activated receptor 4 (F2rl3)

This Recombinant Mouse Proteinase-activated receptor 4 (F2rl3) spans the amino acid sequence from region 60-396.

Product Specifications

Product Name Alternative

Proteinase-activated receptor 4, PAR-4, Coagulation factor II receptor-like 3, Thrombin receptor-like 3

UniProt

O88634

Expression Region

60-396

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GYPGKFCANDSDTLELPASSQALLLGWVPTRLVPALYGLVVAVGLPANGLALWVLATRVP RLPSTILLMNLAVADLLLALVLPPRLAYHLRGQRWPFGEAACRVATAALYGHMYGSVLLL AAVSLDRYLALVHPLRARALRGQRLTTGLCLVAWLSAATLALPLTLHRQTFRLAGSDRML CHDALPLTEQTSHWRPAFICLAVLGCFVPLLAMGLCYGATLRALAANGQRYSHALRLTAL VLFSAVASFTPSNVLLVLHYSNPSPEAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSHEF REKVRAMLCRQPEASSSSQASREAGSRGTAICSSTLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLTPD2 CRISPR/Cas9 KO Plasmid (m)
sc-432140 20 µg

GLTPD2 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
CHO Serum-free Medium for Cells, Dry Powder
M3441 10 L

CHO Serum-free Medium for Cells, Dry Powder

Sign In for Pricing
View Details
MUSK Rabbit Polyclonal Antibody
TA314219 100 µL

MUSK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TBCC, NT (TBCC, Tubulin-specific chaperone C, Tubulin-folding cofactor C) (MaxLight 750)
MBS6354016-01 0.1 mL

TBCC, NT (TBCC, Tubulin-specific chaperone C, Tubulin-folding cofactor C) (MaxLight 750)

Sign In for Pricing
View Details
TBCC, NT (TBCC, Tubulin-specific chaperone C, Tubulin-folding cofactor C) (MaxLight 750)
MBS6354016-02 5x 0.1 mL

TBCC, NT (TBCC, Tubulin-specific chaperone C, Tubulin-folding cofactor C) (MaxLight 750)

Sign In for Pricing
View Details
MRPS25 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1337105 3x 1.0 µg

MRPS25 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details