Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-32 (sra-32)

This Recombinant Serpentine receptor class alpha-32 (sra-32) spans the amino acid sequence from region 1-338.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-32, Protein sra-32

UniProt

Q10934

Expression Region

1-338

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDYAENSFNVIPISMEYIRDLRTATSFRVYVIYIDLVLILALFLSIHAIRELTSKQLFS KSITHLLIASLVYGNVHNASYTIIETWSLYRSFAYSDNMTAIMFTSEECFVQHVLNSCVR FLFIAIELALNVDRIIVILFRKHFHCYPGVRGEILNILAVILSFALGCLLHLKGPHPGIV TTSCFRETDITINLCSTNLTSYTILSACCAALDFLMMWYTWNDRKKINYDLNSQYLKVEQ HHSLMAVSLNSLLQLFVTSIYAISMFVLANMSMTNPELGNANLLRWFYTTPYSTLLVPIQ IKVFIQWIGNRRKRRINTATRVSLTQDGYFTKLSDSWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sh3glb2 (NM_001009692) Rat Untagged Clone
RN200593 10 µg

Sh3glb2 (NM_001009692) Rat Untagged Clone

Sign In for Pricing
View Details
Hamster Alpha-2-Microglobulin Like Protein 1 ELISA Kit
MBS076145-01 48 Well

Hamster Alpha-2-Microglobulin Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Hamster Alpha-2-Microglobulin Like Protein 1 ELISA Kit
MBS076145-02 96 Well

Hamster Alpha-2-Microglobulin Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Hamster Alpha-2-Microglobulin Like Protein 1 ELISA Kit
MBS076145-03 5x 96 Well

Hamster Alpha-2-Microglobulin Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Hamster Alpha-2-Microglobulin Like Protein 1 ELISA Kit
MBS076145-04 10x 96 Well

Hamster Alpha-2-Microglobulin Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
LILRB1 Rabbit Polyclonal Antibody
TA349367 100 µL

LILRB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details