Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-31 (sra-31)

This Recombinant Serpentine receptor class alpha-31 (sra-31) spans the amino acid sequence from region 1-338.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-31, Protein sra-31

UniProt

Q18881

Expression Region

1-338

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIPGKCTSEEIRLTLTSSFMMGNHCFILLIIISSVFLTVFAIRKLWKNNIFPNCTRTLL FSAIINGVVHHWSIAGIRIRTVYRALVYGSDRCSILFQSSECLIESNLYYYTNLFSSLCC ISLFFDRLLSLNAKTSYNTKHFSKIFLLFQSISPFGILYWIFYDSVYTGFVPMCSYPPAT SSLKFHKVNEFRLYILGTFFVLSFVIFFYNRTQEKGIIHNVYDTESRYKSYENLLATRAV CIIIATQITCLVTTASTTEILSAYKSSIPNTILLPSIAFMTGLTYSNFFLPIIIIYQTNR IINQRYNAIKRIQNEKSFATHFASLDLSWKSSKIDNSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mutarotase (GALM) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F8]
TA812316AM 100 µL

Mutarotase (GALM) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F8]

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), Biotin conjugate, 0.1mg/mL
BNCB1577-100 1x 100 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (HSV1/1934), CF568 conjugate, 0.1mg/mL
BNC681934-500 1x 500 µL

HSV1 (Herpes Simplex Virus Type I) (HSV1/1934), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COX1/Cyclooxygenase 1 Rabbit Polyclonal Antibody
0807-3 100 µL

COX1/Cyclooxygenase 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FABP12 Rabbit Polyclonal Antibody
TA367654 100 µL

FABP12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Des-ethyl Luseogliflozin
TRC-D718365-25MG 25 mg

Des-ethyl Luseogliflozin

Sign In for Pricing
View Details