Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 9 (Taar9)

This Recombinant Rat Trace amine-associated receptor 9 (Taar9) spans the amino acid sequence from region 1-338.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 9, TaR-9, Trace amine receptor 9, Trace amine receptor 3, TaR-3

UniProt

Q923Y6

Expression Region

1-338

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELCYENVNGSCIKSSYSPWPRAILYAVLGLGALLAVFGNLLVITAILHFKQLHTPTNFL VASLACADFLVGVTVMPFSTVRSVEGCWYFGDTYCKFHTCFDTSFCFASLFHLCCISIDR YVAVTDPLTYPTKFTISVSGVCIALSWFFSVTYSFSIFYTGANEEGIEELVVALTCVGGC QAPLNQNWVLLCFLLFFLPTVVMVFLYGRIFLVAKQQARKIEGSANQPQASSESYKERVA RRERKAAKTLGIAMAAFLVSWLPYIIDAVIDAYMNFITPAYVYEILVWCVYYNSAMNPLI YAFFYPWFRKAIKLIVSGKVFRADSSRTNLFSEEAGAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLP1R Antibody
A23284-50UG 50 µg

GLP1R Antibody

Sign In for Pricing
View Details
RNF111 Rabbit Polyclonal Antibody (BF750)
orb2549090 100 µL

RNF111 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
H4C9 Antibody
orb1554794-01 50 μL

H4C9 Antibody

Sign In for Pricing
View Details
H4C9 Antibody
orb1554794-02 100 µL

H4C9 Antibody

Sign In for Pricing
View Details
H4C9 Antibody
orb1554794-03 200 µL

H4C9 Antibody

Sign In for Pricing
View Details
Human Centromere protein C 1, CENPC1 ELISA KIT
ELI-25498h 96 Tests

Human Centromere protein C 1, CENPC1 ELISA KIT

Sign In for Pricing
View Details