Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 9 (Taar9)

This Recombinant Rat Trace amine-associated receptor 9 (Taar9) spans the amino acid sequence from region 1-338.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 9, TaR-9, Trace amine receptor 9, Trace amine receptor 3, TaR-3

UniProt

Q923Y6

Expression Region

1-338

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELCYENVNGSCIKSSYSPWPRAILYAVLGLGALLAVFGNLLVITAILHFKQLHTPTNFL VASLACADFLVGVTVMPFSTVRSVEGCWYFGDTYCKFHTCFDTSFCFASLFHLCCISIDR YVAVTDPLTYPTKFTISVSGVCIALSWFFSVTYSFSIFYTGANEEGIEELVVALTCVGGC QAPLNQNWVLLCFLLFFLPTVVMVFLYGRIFLVAKQQARKIEGSANQPQASSESYKERVA RRERKAAKTLGIAMAAFLVSWLPYIIDAVIDAYMNFITPAYVYEILVWCVYYNSAMNPLI YAFFYPWFRKAIKLIVSGKVFRADSSRTNLFSEEAGAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat NT5C2 (5'-Nucleotidase, Cytosolic II) ELISA Kit
MBS8806507-01 48 Well

Rat NT5C2 (5'-Nucleotidase, Cytosolic II) ELISA Kit

Sign In for Pricing
View Details
Rat NT5C2 (5'-Nucleotidase, Cytosolic II) ELISA Kit
MBS8806507-02 96 Well

Rat NT5C2 (5'-Nucleotidase, Cytosolic II) ELISA Kit

Sign In for Pricing
View Details
Rat NT5C2 (5'-Nucleotidase, Cytosolic II) ELISA Kit
MBS8806507-03 5x 96 Well

Rat NT5C2 (5'-Nucleotidase, Cytosolic II) ELISA Kit

Sign In for Pricing
View Details
Rat NT5C2 (5'-Nucleotidase, Cytosolic II) ELISA Kit
MBS8806507-04 10x 96 Well

Rat NT5C2 (5'-Nucleotidase, Cytosolic II) ELISA Kit

Sign In for Pricing
View Details
Recombinant human Creatine Kinase MM protein, N-His
bs-41113P-01 20 µg

Recombinant human Creatine Kinase MM protein, N-His

Sign In for Pricing
View Details
Recombinant human Creatine Kinase MM protein, N-His
bs-41113P-02 100 µg

Recombinant human Creatine Kinase MM protein, N-His

Sign In for Pricing
View Details