Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 9 (Taar9)

This Recombinant Rat Trace amine-associated receptor 9 (Taar9) spans the amino acid sequence from region 1-338.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 9, TaR-9, Trace amine receptor 9, Trace amine receptor 3, TaR-3

UniProt

Q923Y6

Expression Region

1-338

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELCYENVNGSCIKSSYSPWPRAILYAVLGLGALLAVFGNLLVITAILHFKQLHTPTNFL VASLACADFLVGVTVMPFSTVRSVEGCWYFGDTYCKFHTCFDTSFCFASLFHLCCISIDR YVAVTDPLTYPTKFTISVSGVCIALSWFFSVTYSFSIFYTGANEEGIEELVVALTCVGGC QAPLNQNWVLLCFLLFFLPTVVMVFLYGRIFLVAKQQARKIEGSANQPQASSESYKERVA RRERKAAKTLGIAMAAFLVSWLPYIIDAVIDAYMNFITPAYVYEILVWCVYYNSAMNPLI YAFFYPWFRKAIKLIVSGKVFRADSSRTNLFSEEAGAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Matrix Metalloproteinase 8 (MMP8) Polyclonal Antibody
CAU30940-01 100 µL

Matrix Metalloproteinase 8 (MMP8) Polyclonal Antibody

Sign In for Pricing
View Details
Matrix Metalloproteinase 8 (MMP8) Polyclonal Antibody
CAU30940-02 200 µL

Matrix Metalloproteinase 8 (MMP8) Polyclonal Antibody

Sign In for Pricing
View Details
Trpc2-set siRNA/shRNA/RNAi Lentivector (Mouse)
48508094 4x 500 ng

Trpc2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Tissue, Membrane Protein, Human Adult Normal, Heart, Atrium (right) HisTekTM
T5595-2087 100 µg

Tissue, Membrane Protein, Human Adult Normal, Heart, Atrium (right) HisTekTM

Sign In for Pricing
View Details
Bovine Interleukin 16 (IL16) ELISA Kit
EK14773 48 Tests

Bovine Interleukin 16 (IL16) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal mCherry Antibody [PE]
NBP2-25157PE 0.1 mL

Rabbit Polyclonal mCherry Antibody [PE]

Sign In for Pricing
View Details