Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-7 (srg-7)

This Recombinant Serpentine receptor class gamma-7 (srg-7) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-7, Protein srg-7

UniProt

P54129

Expression Region

1-339

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASSPPIYNLEQYGTNCSEEYSNFYENSKYWIQCLWLIPTLFLLVWIIITTRVRYPSQYS NLPYWILTADCVVSIILILLDLFVVRLFLYFPQLCSKFSTIFINYPIISDIYFPIYNYAR VFKTGSQCGMILSRLFCVLIPFGHDEKLRRHIPLFLTIICILPILVVWNTVISEKEVVFW YGGFFVIYHRRVGWVSLSKLHLTFIFVSISFILISSLLLMRHLPIESAVNAERRVITNSI FIIVAFFFQAAFQSFYAFFRYTDWYPRFLVDFQFIIYDVMTVGYPLIFLNFAKEFRNHVF LKSNRKGRTLMELRSMSKPFNNTMPRQESPSPNYDSILA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lebercilin (LCA5) activation kit by CRISPRa
GA116161 1 Kit

Human Lebercilin (LCA5) activation kit by CRISPRa

Sign In for Pricing
View Details
Chlorpheniramine Maleate Salt
TRC-C424300-250MG 250 mg

Chlorpheniramine Maleate Salt

Sign In for Pricing
View Details
Aco2 Mouse Gene Knockout Kit (CRISPR)
KN500726 1 Kit

Aco2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BAX Mouse Monoclonal Antibody [3-D2]
EM1203 100 µL

BAX Mouse Monoclonal Antibody [3-D2]

Sign In for Pricing
View Details
Recombinant Mouse TYRO3/DTK Protein (mFc Tag)
PKSM041179-01 10 µg

Recombinant Mouse TYRO3/DTK Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant Mouse TYRO3/DTK Protein (mFc Tag)
PKSM041179-02 50 µg

Recombinant Mouse TYRO3/DTK Protein (mFc Tag)

Sign In for Pricing
View Details