Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-7 (srg-7)

This Recombinant Serpentine receptor class gamma-7 (srg-7) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-7, Protein srg-7

UniProt

P54129

Expression Region

1-339

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASSPPIYNLEQYGTNCSEEYSNFYENSKYWIQCLWLIPTLFLLVWIIITTRVRYPSQYS NLPYWILTADCVVSIILILLDLFVVRLFLYFPQLCSKFSTIFINYPIISDIYFPIYNYAR VFKTGSQCGMILSRLFCVLIPFGHDEKLRRHIPLFLTIICILPILVVWNTVISEKEVVFW YGGFFVIYHRRVGWVSLSKLHLTFIFVSISFILISSLLLMRHLPIESAVNAERRVITNSI FIIVAFFFQAAFQSFYAFFRYTDWYPRFLVDFQFIIYDVMTVGYPLIFLNFAKEFRNHVF LKSNRKGRTLMELRSMSKPFNNTMPRQESPSPNYDSILA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM4SF18 (NM_001184723) Human Over-expression Lysate
LC432679 20 µg

TM4SF18 (NM_001184723) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin-19 Antibody
KC-277-01 50 μL

Cytokeratin-19 Antibody

Sign In for Pricing
View Details
Cytokeratin-19 Antibody
KC-277-02 100 µL

Cytokeratin-19 Antibody

Sign In for Pricing
View Details
Cytokeratin-19 Antibody
KC-277-03 1 mL

Cytokeratin-19 Antibody

Sign In for Pricing
View Details
2-Bromoethylamine Hydrobromide
TRC-B683750-500G 500 g

2-Bromoethylamine Hydrobromide

Sign In for Pricing
View Details
Mouse AGO2 Protein, His Tag
AG2-M5543-1mg 1 mg

Mouse AGO2 Protein, His Tag

Sign In for Pricing
View Details