Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dipeptide transport system permease protein dppB (dppB)

This Recombinant Dipeptide transport system permease protein dppB (dppB) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Dipeptide transport system permease protein dppB

UniProt

P0AEG0

Expression Region

1-339

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVMIMAGERGISPERHAQLLAELGLDK PMWQQYLHYIWGVMHGDLGISMKSRIPVWEEFVPRFQATLELGVCAMIFATAVGIPVGVL AAVKRGSIFDHTAVGLALTGYSMPIFWWGMMLIMLVSVHWNLTPVSGRVSDMVFLDDSNP LTGFMLIDTAIWGEDGNFIDAVAHMILPAIVLGTIPLAVIVRMTRSSMLEVLGEDYIRTA RAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDALQR RDYPVVQGGVLLVATMIILVNLLVDLLYGVVNPRIRHKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFB5 Protein Vector (Rat) (pPB-C-His)
PV284742 500 ng

NDUFB5 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Kctd17 Mouse Gene Knockout Kit (CRISPR)
KN508710 1 Kit

Kctd17 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Dog Cell division control protein 42 homolog (CDC42)
MBS952254-01 0.02 mg (E-Coli)

Recombinant Dog Cell division control protein 42 homolog (CDC42)

Sign In for Pricing
View Details
Recombinant Dog Cell division control protein 42 homolog (CDC42)
MBS952254-02 0.1 mg (E-Coli)

Recombinant Dog Cell division control protein 42 homolog (CDC42)

Sign In for Pricing
View Details
Recombinant Dog Cell division control protein 42 homolog (CDC42)
MBS952254-03 0.02 mg (Yeast)

Recombinant Dog Cell division control protein 42 homolog (CDC42)

Sign In for Pricing
View Details
Recombinant Dog Cell division control protein 42 homolog (CDC42)
MBS952254-04 0.1 mg (Yeast)

Recombinant Dog Cell division control protein 42 homolog (CDC42)

Sign In for Pricing
View Details