Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-32 (srd-32)

This Recombinant Serpentine receptor class delta-32 (srd-32) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-32, Protein srd-32

UniProt

O01608

Expression Region

1-339

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVDIYDQLYISYAAVVSTLGIIFNGFLLFLIFFKSPSCLTPYTVFLANTSITQLGYCIC FLLTVPRVISINLRIVNIYLGFSQFLGHWWSYMIFTTMLHFAVNSFLSIMLSMVFRCISL KTLRFPTSGAFAMCILAYMIPLSMVVSIRGIEITSNFTINSKYTLWQLENLDKYRTVVGT TMAQLSTLWVACCVSILCIPIYSVMFWCRYRILRMLERPGYMFNTTTTLQIKRLVKALTV QSLIPVFTLFPASLIFLSTQFHVIETTKFGYIIISLLSLSPTIDPLVTIYYVQPYRKYIV DLLWSEERPMVSPFLSNNDPRFYRSRSNSVLMMRNTHFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FTL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV710253 1.0 µg DNA

FTL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral human XPNPEP2 shRNA (UAS) - Lentiviral human XPNPEP2 shRNA (UAS, iRFP) (25)
GTR15348497 1 Vial

Lentiviral human XPNPEP2 shRNA (UAS) - Lentiviral human XPNPEP2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal FOLR4 Antibody [DyLight 650]
NBP2-99508C 0.1 mL

Rabbit Polyclonal FOLR4 Antibody [DyLight 650]

Sign In for Pricing
View Details
Lamin B1 Monoclonal Antibody, AbBy Fluor™ 488 Conjugated
bsm-33442M-BF488 100 µL

Lamin B1 Monoclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Porcine Trans-2-Enoyl-CoA Reductase, Mitochondrial (MECR) ELISA Kit
MBS9381312-01 48 Well

Porcine Trans-2-Enoyl-CoA Reductase, Mitochondrial (MECR) ELISA Kit

Sign In for Pricing
View Details
Porcine Trans-2-Enoyl-CoA Reductase, Mitochondrial (MECR) ELISA Kit
MBS9381312-02 96 Well

Porcine Trans-2-Enoyl-CoA Reductase, Mitochondrial (MECR) ELISA Kit

Sign In for Pricing
View Details