Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-32 (srd-32)

This Recombinant Serpentine receptor class delta-32 (srd-32) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-32, Protein srd-32

UniProt

O01608

Expression Region

1-339

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVDIYDQLYISYAAVVSTLGIIFNGFLLFLIFFKSPSCLTPYTVFLANTSITQLGYCIC FLLTVPRVISINLRIVNIYLGFSQFLGHWWSYMIFTTMLHFAVNSFLSIMLSMVFRCISL KTLRFPTSGAFAMCILAYMIPLSMVVSIRGIEITSNFTINSKYTLWQLENLDKYRTVVGT TMAQLSTLWVACCVSILCIPIYSVMFWCRYRILRMLERPGYMFNTTTTLQIKRLVKALTV QSLIPVFTLFPASLIFLSTQFHVIETTKFGYIIISLLSLSPTIDPLVTIYYVQPYRKYIV DLLWSEERPMVSPFLSNNDPRFYRSRSNSVLMMRNTHFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX18 (T-Box 18) (AP)
MBS6162774-01 0.1 mL

TBX18 (T-Box 18) (AP)

Sign In for Pricing
View Details
TBX18 (T-Box 18) (AP)
MBS6162774-02 5x 0.1 mL

TBX18 (T-Box 18) (AP)

Sign In for Pricing
View Details
Cadherin antibody
MBS5300316-01 0.1 mg

Cadherin antibody

Sign In for Pricing
View Details
Cadherin antibody
MBS5300316-02 5x 0.1 mg

Cadherin antibody

Sign In for Pricing
View Details
Vertical freeze dryer; Desktop freeze dryer
E1706 1 Unit

Vertical freeze dryer; Desktop freeze dryer

Sign In for Pricing
View Details
UGT8 siRNA (Rat)
CRR1375-01 15 nmol

UGT8 siRNA (Rat)

Sign In for Pricing
View Details