Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-32 (srd-32)

This Recombinant Serpentine receptor class delta-32 (srd-32) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-32, Protein srd-32

UniProt

O01608

Expression Region

1-339

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVDIYDQLYISYAAVVSTLGIIFNGFLLFLIFFKSPSCLTPYTVFLANTSITQLGYCIC FLLTVPRVISINLRIVNIYLGFSQFLGHWWSYMIFTTMLHFAVNSFLSIMLSMVFRCISL KTLRFPTSGAFAMCILAYMIPLSMVVSIRGIEITSNFTINSKYTLWQLENLDKYRTVVGT TMAQLSTLWVACCVSILCIPIYSVMFWCRYRILRMLERPGYMFNTTTTLQIKRLVKALTV QSLIPVFTLFPASLIFLSTQFHVIETTKFGYIIISLLSLSPTIDPLVTIYYVQPYRKYIV DLLWSEERPMVSPFLSNNDPRFYRSRSNSVLMMRNTHFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYCE3 Rabbit Polyclonal Antibody
TA365263 100 µL

SYCE3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WBS16, NT (WBSCR16, Williams-Beuren syndrome chromosomal region 16 protein, RCC1-like G exchanging factor-like protein) (MaxLight 490) discontinued
043809-ML490 100 µL

WBS16, NT (WBSCR16, Williams-Beuren syndrome chromosomal region 16 protein, RCC1-like G exchanging factor-like protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
SARS-CoV-2 (COVID-19) Beta Variant (B.1.351, SA) Spike S1 (RBD) Recombinant Protein
orb1231046 50 µg

SARS-CoV-2 (COVID-19) Beta Variant (B.1.351, SA) Spike S1 (RBD) Recombinant Protein

Sign In for Pricing
View Details
JTB protein, Human, Recombinant (His)
E51P90826 20 µg

JTB protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Mouse Monoclonal TRAP alpha Antibody (OTI4C7) [DyLight 488]
NBP2-74591G 0.1 mL

Mouse Monoclonal TRAP alpha Antibody (OTI4C7) [DyLight 488]

Sign In for Pricing
View Details
Anti-Phospho-FoxO1/3/4 (T24/32) Antibody
A00073T24-1 100 µL

Anti-Phospho-FoxO1/3/4 (T24/32) Antibody

Sign In for Pricing
View Details