Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-32 (srd-32)

This Recombinant Serpentine receptor class delta-32 (srd-32) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-32, Protein srd-32

UniProt

O01608

Expression Region

1-339

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVDIYDQLYISYAAVVSTLGIIFNGFLLFLIFFKSPSCLTPYTVFLANTSITQLGYCIC FLLTVPRVISINLRIVNIYLGFSQFLGHWWSYMIFTTMLHFAVNSFLSIMLSMVFRCISL KTLRFPTSGAFAMCILAYMIPLSMVVSIRGIEITSNFTINSKYTLWQLENLDKYRTVVGT TMAQLSTLWVACCVSILCIPIYSVMFWCRYRILRMLERPGYMFNTTTTLQIKRLVKALTV QSLIPVFTLFPASLIFLSTQFHVIETTKFGYIIISLLSLSPTIDPLVTIYYVQPYRKYIV DLLWSEERPMVSPFLSNNDPRFYRSRSNSVLMMRNTHFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal TNNI3 Antibody (monoclonal) (M04), Clone: 1E8
AMM04223G 0.1mg

Monoclonal TNNI3 Antibody (monoclonal) (M04), Clone: 1E8

Sign In for Pricing
View Details
2-Bromo-4-methoxy-6-fluorophenylboronic acid
PC1022838 1 Each

2-Bromo-4-methoxy-6-fluorophenylboronic acid

Sign In for Pricing
View Details
Mouse Monoclonal DPP10 Antibody (OTI1A5) [Alexa Fluor 750]
NBP2-72089AF750 0.1 mL

Mouse Monoclonal DPP10 Antibody (OTI1A5) [Alexa Fluor 750]

Sign In for Pricing
View Details
Lentiviral human RPL3 sgRNA gene knockout kit - Lentiviral human RPL3 sgRNA gene knockout kit (25)
GTR15361284 1 Vial

Lentiviral human RPL3 sgRNA gene knockout kit - Lentiviral human RPL3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Hdac1 (NM_001025409) Rat Untagged Clone
RN205681 10 µg

Hdac1 (NM_001025409) Rat Untagged Clone

Sign In for Pricing
View Details
PTP4A2 Polyclonal Antibody
MBS2555644-01 0.06 mL

PTP4A2 Polyclonal Antibody

Sign In for Pricing
View Details