Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-32 (srd-32)

This Recombinant Serpentine receptor class delta-32 (srd-32) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-32, Protein srd-32

UniProt

O01608

Expression Region

1-339

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVDIYDQLYISYAAVVSTLGIIFNGFLLFLIFFKSPSCLTPYTVFLANTSITQLGYCIC FLLTVPRVISINLRIVNIYLGFSQFLGHWWSYMIFTTMLHFAVNSFLSIMLSMVFRCISL KTLRFPTSGAFAMCILAYMIPLSMVVSIRGIEITSNFTINSKYTLWQLENLDKYRTVVGT TMAQLSTLWVACCVSILCIPIYSVMFWCRYRILRMLERPGYMFNTTTTLQIKRLVKALTV QSLIPVFTLFPASLIFLSTQFHVIETTKFGYIIISLLSLSPTIDPLVTIYYVQPYRKYIV DLLWSEERPMVSPFLSNNDPRFYRSRSNSVLMMRNTHFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRFIP2 Protein Vector (Mouse) (pPB-N-His)
PV197879 500 ng

LRRFIP2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
RNF21 Polyclonal Antibody
bs-9244R 100 µL

RNF21 Polyclonal Antibody

Sign In for Pricing
View Details
ISO 9377-2-Mod, n-Alkane Standard Solution, 16 components, C10-C40 (all even) 100mg/l each in n-Hexane / Petroleum ether
P858210P 1 mL

ISO 9377-2-Mod, n-Alkane Standard Solution, 16 components, C10-C40 (all even) 100mg/l each in n-Hexane / Petroleum ether

Sign In for Pricing
View Details
C7orf36, ID (YAE1D1, C7orf36, Yae1 domain-containing protein 1) (APC)
MBS6280057-01 0.2 mL

C7orf36, ID (YAE1D1, C7orf36, Yae1 domain-containing protein 1) (APC)

Sign In for Pricing
View Details
C7orf36, ID (YAE1D1, C7orf36, Yae1 domain-containing protein 1) (APC)
MBS6280057-02 5x 0.2 mL

C7orf36, ID (YAE1D1, C7orf36, Yae1 domain-containing protein 1) (APC)

Sign In for Pricing
View Details
Chicken Polyclonal Sirtuin 3/SIRT3 Antibody
NBP1-76264-0.025mg 0.025 mg

Chicken Polyclonal Sirtuin 3/SIRT3 Antibody

Sign In for Pricing
View Details