Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-24 (sra-24)

This Recombinant Serpentine receptor class alpha-24 (sra-24) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-24, Protein sra-24

UniProt

O62368

Expression Region

1-339

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKTAEEIVESRRCASEGLTNALTSITVKMSSVLVVTVILLSYYFARLAIRTLWKNNIFS NSTRLILLVCLLNSIIHQTTMLEIRIRQIYRSIVFASEPCRLPFHFTECEVELFVYYLTT YFSTYSVFSLAFDRLISCYTPKYYLSHQYYVSIFLLFIQLIFTLGTYYVGLYGVPPLGYE PFCNYAPKLATNFVKINDFRTLIMGICIIVTVFVYYLSVKSEKQIQQTSYSPGERYIAYE NVAASQSVCILIVLQFACILISSLGVNYLRIFKSTLSDEEYNKLAPFFVGVTYANLCLPL VIHCKTKLTIRNRKLRIGVMTSMYGDVGEHINRLKKSWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Tight Junction Protein 2 Antibody
NBP1-86850-25ul 25 µL

Rabbit Polyclonal Tight Junction Protein 2 Antibody

Sign In for Pricing
View Details
APC anti-human Delta-like protein 4 (DLL4)
GT12351 100 Tests

APC anti-human Delta-like protein 4 (DLL4)

Sign In for Pricing
View Details
Cy5 maleimide
MBS5816126 Inquire

Cy5 maleimide

Sign In for Pricing
View Details
Reg3d AAV Vector (Mouse) (CMV)
38798105 1 µg

Reg3d AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Alkbh1 Mouse qPCR Primer Pair (NM_001102565)
MP222145 200 Reactions

Alkbh1 Mouse qPCR Primer Pair (NM_001102565)

Sign In for Pricing
View Details
Mouse Olfr1243 (NM_146969) AAV Particle
MR213821A1V 250 µL

Mouse Olfr1243 (NM_146969) AAV Particle

Sign In for Pricing
View Details