Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-24 (sra-24)

This Recombinant Serpentine receptor class alpha-24 (sra-24) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-24, Protein sra-24

UniProt

O62368

Expression Region

1-339

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKTAEEIVESRRCASEGLTNALTSITVKMSSVLVVTVILLSYYFARLAIRTLWKNNIFS NSTRLILLVCLLNSIIHQTTMLEIRIRQIYRSIVFASEPCRLPFHFTECEVELFVYYLTT YFSTYSVFSLAFDRLISCYTPKYYLSHQYYVSIFLLFIQLIFTLGTYYVGLYGVPPLGYE PFCNYAPKLATNFVKINDFRTLIMGICIIVTVFVYYLSVKSEKQIQQTSYSPGERYIAYE NVAASQSVCILIVLQFACILISSLGVNYLRIFKSTLSDEEYNKLAPFFVGVTYANLCLPL VIHCKTKLTIRNRKLRIGVMTSMYGDVGEHINRLKKSWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMIQ4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
13357061 1.0 µg DNA

BMIQ4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At1g62270 Polyclonal Antibody
MBS7181194 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At1g62270 Polyclonal Antibody

Sign In for Pricing
View Details
RPS24 Human Over-expression Lysate
orb1360889 20 µg

RPS24 Human Over-expression Lysate

Sign In for Pricing
View Details
CNR1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-1683R-BF647-01 20 µL

CNR1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
CNR1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-1683R-BF647-02 100 µL

CNR1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
2- (5-Cyclopropyl-1H-indol-3-yl) acetic acid
OR86638-01 100 mg

2- (5-Cyclopropyl-1H-indol-3-yl) acetic acid

Sign In for Pricing
View Details