Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class r-10 (odr-10)

This Recombinant Serpentine receptor class r-10 (odr-10) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Serpentine receptor class r-10, Odorant response abnormal protein 10, Olfactory receptor 10

UniProt

Q18807

Expression Region

1-339

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGELWITLVDTADIVGVTLTFCVNIVLLGLLKTRGKNLGTYKYLMAFFSVFSIFYAIIE FILRPIMHIENTTFFLISRKRFNYSTKLGKINSAFYCACFATSFVVSGVHFVYRYFATCK PNLLRLFNLPTLLLWPLGCSVPVTMWASVSYFLYPDTEYTEAAVTNVLNNHYNWIKKENV SYIAYVYYQYENGVRHIYLKNLLGCFVHYFVMSMTFVVMFYCGYATWKTMNEHKDVSDRT RALQKQLFKALVLQTLIPTIFMYAPTGVMFIAPFFDVNLNANANFIVFCSFLYPGLDPLI LILIIRDFRRTIFNFLCGKKNSVDESRSTTRANLSQVPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-500 1x 500 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF488A conjugate, 0.1mg/mL
BNC880871-100 1x 100 µL

CD71 (66IG10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF568 conjugate, 0.1mg/mL
BNC680861-500 1x 500 µL

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-100 1x 100 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF647 conjugate, 0.1mg/mL
BNC470176-500 1x 500 µL

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
BNC040226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details