Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Formyl peptide receptor-related sequence 6 (Fpr-rs6)

This Recombinant Mouse Formyl peptide receptor-related sequence 6 (Fpr-rs6) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Formyl peptide receptor-related sequence 6

UniProt

Q3SXG2

Expression Region

1-339

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEANFSIPQNGSEVVFYDSTTSRVICIFLVVVLSITFLLGVIGNGLVIYVAGFRMTHTVT TICYLNLALSDFSYMASLPFQITSIVMNGEWLFGWFLCKFVHMIINVNLFLSIFLITFIA MDRCICVLHPVWAQNHRTVNVATKVIFGAWILVLMLIFPHCIFVTTVKDESGKVHCICNF ESWAATPEEQVKVSMTVSLISVTISFIIGFSIPMIFIVICYGLMAAKIGRRGFVNSSRPL RVLTAVAISFFVCWFPFQLIFLLGNIGNKETQNNIDTWVNTASTLASFNSCLNPILYVFL GQQFRERLIYSLSASLERALREDSALNSDKTRNLSSQRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD28 Recombinant Rabbit monoclonal Antibody
HA723459B 100 µL

Human CD28 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human PAXBP1 activation kit by CRISPRa
GA114329 1 Kit

Human PAXBP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF647 conjugate, 0.1mg/mL
BNC471540-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PI4K2A (N-term) Rabbit Polyclonal Antibody
AP14956PU-N 400 µL

PI4K2A (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD96 Protein (mFc Tag)
PKSH033504-01 10 µg

Recombinant Human CD96 Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant Human CD96 Protein (mFc Tag)
PKSH033504-02 50 µg

Recombinant Human CD96 Protein (mFc Tag)

Sign In for Pricing
View Details