Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Formyl peptide receptor-related sequence 6 (Fpr-rs6)

This Recombinant Mouse Formyl peptide receptor-related sequence 6 (Fpr-rs6) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Formyl peptide receptor-related sequence 6

UniProt

Q3SXG2

Expression Region

1-339

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEANFSIPQNGSEVVFYDSTTSRVICIFLVVVLSITFLLGVIGNGLVIYVAGFRMTHTVT TICYLNLALSDFSYMASLPFQITSIVMNGEWLFGWFLCKFVHMIINVNLFLSIFLITFIA MDRCICVLHPVWAQNHRTVNVATKVIFGAWILVLMLIFPHCIFVTTVKDESGKVHCICNF ESWAATPEEQVKVSMTVSLISVTISFIIGFSIPMIFIVICYGLMAAKIGRRGFVNSSRPL RVLTAVAISFFVCWFPFQLIFLLGNIGNKETQNNIDTWVNTASTLASFNSCLNPILYVFL GQQFRERLIYSLSASLERALREDSALNSDKTRNLSSQRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Naphthoic Acid (2-Naphthalenecarboxylic Acid)
TRC-N345640-5G 5 g

2-Naphthoic Acid (2-Naphthalenecarboxylic Acid)

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), 1mg/mL
BNUM1761-50 1x 50 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), 1mg/mL

Sign In for Pricing
View Details
BCAS2 (NM_005872) Human Recombinant Protein
TP305615M 100 µg

BCAS2 (NM_005872) Human Recombinant Protein

Sign In for Pricing
View Details
TentaGel® HL COOH
HL12903.1G 1 g

TentaGel® HL COOH

Sign In for Pricing
View Details
Lactoylglutathione Lyase (CPTC-GLO1-1), CF488A conjugate, 0.1mg/mL
BNC882258-100 1x 100 µL

Lactoylglutathione Lyase (CPTC-GLO1-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FGFR1OP2 (NM_015633) Human Recombinant Protein
TP318080M 100 µg

FGFR1OP2 (NM_015633) Human Recombinant Protein

Sign In for Pricing
View Details