Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Formyl peptide receptor-related sequence 6 (Fpr-rs6)

This Recombinant Mouse Formyl peptide receptor-related sequence 6 (Fpr-rs6) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Formyl peptide receptor-related sequence 6

UniProt

Q3SXG2

Expression Region

1-339

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEANFSIPQNGSEVVFYDSTTSRVICIFLVVVLSITFLLGVIGNGLVIYVAGFRMTHTVT TICYLNLALSDFSYMASLPFQITSIVMNGEWLFGWFLCKFVHMIINVNLFLSIFLITFIA MDRCICVLHPVWAQNHRTVNVATKVIFGAWILVLMLIFPHCIFVTTVKDESGKVHCICNF ESWAATPEEQVKVSMTVSLISVTISFIIGFSIPMIFIVICYGLMAAKIGRRGFVNSSRPL RVLTAVAISFFVCWFPFQLIFLLGNIGNKETQNNIDTWVNTASTLASFNSCLNPILYVFL GQQFRERLIYSLSASLERALREDSALNSDKTRNLSSQRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit IgG heavy chain Mouse Monoclonal Antibody [C3-C8]
M1009-6 100 µL

Rabbit IgG heavy chain Mouse Monoclonal Antibody [C3-C8]

Sign In for Pricing
View Details
FXYD2 (NM_001680) Human Over-expression Lysate
LY419804 100 µg

FXYD2 (NM_001680) Human Over-expression Lysate

Sign In for Pricing
View Details
Dibenzyl N,N-Diisopropylphosphoramidite
TRC-D417500-50G 50 g

Dibenzyl N,N-Diisopropylphosphoramidite

Sign In for Pricing
View Details
GPNMB Human Gene Knockout Kit (CRISPR)
KN207615RB 1 Kit

GPNMB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Endothelin-3 (C-term) Rabbit Polyclonal Antibody
AP51366PU-N 400 µL

Endothelin-3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZFP200 (ZNF200) (NM_003454) Human Recombinant Protein
TP307594L 1 mg

ZFP200 (ZNF200) (NM_003454) Human Recombinant Protein

Sign In for Pricing
View Details