Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vomeronasal type-1 receptor A14 (V1ra14)

This Recombinant Rat Vomeronasal type-1 receptor A14 (V1ra14) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Vomeronasal type-1 receptor A14

UniProt

Q5J3K9

Expression Region

1-339

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGVQICQGMMSEIPFFSPPPQFSYMMNKNIRLHTDSNIRNTFFTDIGIGISANSLLLLF NIFKLTRGQRSRLTDLPIGLLSLINLLMLLMAAFIATDTFISWKGWDDIICKFLVYLYRT FRGLSLCTSCLLSVLQAIILSPRSSCLAKFKHKPPHHISCAILSLSVLYMFIGSHLLVSI IATPNLTTNDFIHVTQSCSILPMSYLMQCMFSTLLAIRDVFLISLMVLSTWYMVALLCRH RKQTRHLQGTSLSPKASPEQRATRSILMLMSLFVLMSVFDSIVCSSRTMYLNDPISYSIQ LFMVHIYATVSPFVFIVTEKHIVNFLRSVCEGDECLNIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF647 conjugate, 0.1mg/mL
BNC470324-100 1x 100 µL

CD53 (161-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL
BNC680437-500 1x 500 µL

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-500 1x 500 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-100 1x 100 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), CF647 conjugate, 0.1mg/mL
BNC471485-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calpain 1 (CAPN1/1530), CF568 conjugate, 0.1mg/mL
BNC681530-500 1x 500 µL

Calpain 1 (CAPN1/1530), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details