Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 2 (Taar2)

This Recombinant Rat Trace amine-associated receptor 2 (Taar2) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 2, TaR-2, Trace amine receptor 2, G-protein coupled receptor 58

UniProt

Q5QD25

Expression Region

1-339

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSFEAQQETFDCSEYGNGSCPENERSLGVRAAMYSLMAGAIFITIFGNLVMIISISYFK QLHTPTNLLILSMAVTDFLLGFTIMPYSMVRSVENCWYFGLTFCKIHYSFDLMLSITSIF HLCSVAIDRFYAICHPLHYCTKMTIPVVKRLLLVCWSVPGAFAFGVVFSEAYADGIEGYD ILVACSSSCPVMFNKLWGTTLFVAGFFTPSSMMVGIYGKIFAVSKKHARVIDNLPENQNN QMRKDKKAAKTLGIVMGVFLLCWFPCFFTILLDPFLNFSTPAILFDALTWFGYFNSTCNP LIYGFFYPWFRRALRYILLGKIFSSHFHNTNLFTQKETE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptpru Mouse Gene Knockout Kit (CRISPR)
KN514242 1 Kit

Ptpru Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SF3A1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G6]
TA800543BM 100 µL

SF3A1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G6]

Sign In for Pricing
View Details
Loxapine N-Glucuronide
TRC-L473860-10MG 10 mg

Loxapine N-Glucuronide

Sign In for Pricing
View Details
NDRG2 Rabbit Polyclonal Antibody
ER1802-94 100 µL

NDRG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), Biotin conjugate, 0.1mg/mL
BNCB1964-500 1x 500 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RSPO3 Antibody
KC-2961-01 50 μL

RSPO3 Antibody

Sign In for Pricing
View Details