Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 2 (Taar2)

This Recombinant Mouse Trace amine-associated receptor 2 (Taar2) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 2, TaR-2, Trace amine receptor 2, G-protein coupled receptor 58

UniProt

Q5QD17

Expression Region

1-339

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASFEAQQETFDCSEYGNGSCPENERSLGVRAAMYSLMACAIFITIFGNLAMIISISYFK QLHTPTNLLILSMAVTDFLLGFTIMPYSMVRSVENCWYFGLTFCKIHYSFDLMLSITSIF HLCSVAVDRFYAICHPLHYCTKMTIPVVRRLLLVCWSVPGAFAFGVVFSEAYADGIEGYD ILVACSSSCPVMFNKLWGTTLFVAGFFTPSSMMVGIYGKIFAVSKKHARVIDNLPENQNN QMRKDKKAAKTLGIVMGVFLLCWFPCFFTILLDPFLNFSTPAVLFDALTWFGYFNSTCNP LIYGFFYPWFRRALKYILLGKIFSSHFHNTNLFTQKETE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DRB5 Rabbit Polyclonal Antibody
TA370098 100 µL

HLA-DRB5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PYURF activation kit by CRISPRa
GA119435 1 Kit

Human PYURF activation kit by CRISPRa

Sign In for Pricing
View Details
MCK10 (DDR1) (NM_001954) Human Over-expression Lysate
LC400719 20 µg

MCK10 (DDR1) (NM_001954) Human Over-expression Lysate

Sign In for Pricing
View Details
SHMT1 Antibody
KC-2017-01 50 μL

SHMT1 Antibody

Sign In for Pricing
View Details
SHMT1 Antibody
KC-2017-02 100 µL

SHMT1 Antibody

Sign In for Pricing
View Details
SHMT1 Antibody
KC-2017-03 1 mL

SHMT1 Antibody

Sign In for Pricing
View Details