Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 2 (Taar2)

This Recombinant Mouse Trace amine-associated receptor 2 (Taar2) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 2, TaR-2, Trace amine receptor 2, G-protein coupled receptor 58

UniProt

Q5QD17

Expression Region

1-339

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASFEAQQETFDCSEYGNGSCPENERSLGVRAAMYSLMACAIFITIFGNLAMIISISYFK QLHTPTNLLILSMAVTDFLLGFTIMPYSMVRSVENCWYFGLTFCKIHYSFDLMLSITSIF HLCSVAVDRFYAICHPLHYCTKMTIPVVRRLLLVCWSVPGAFAFGVVFSEAYADGIEGYD ILVACSSSCPVMFNKLWGTTLFVAGFFTPSSMMVGIYGKIFAVSKKHARVIDNLPENQNN QMRKDKKAAKTLGIVMGVFLLCWFPCFFTILLDPFLNFSTPAVLFDALTWFGYFNSTCNP LIYGFFYPWFRRALKYILLGKIFSSHFHNTNLFTQKETE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALK2 (N-term) Rabbit Polyclonal Antibody
AP13662PU-N 400 µL

GALK2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mefenamic-d4 Acid
TRC-M205053-1MG 1 mg

Mefenamic-d4 Acid

Sign In for Pricing
View Details
Abracl Mouse Gene Knockout Kit (CRISPR)
KN500677 1 Kit

Abracl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SEPTIN4 (NM_080415) Human Over-expression Lysate
LY403307 100 µg

SEPTIN4 (NM_080415) Human Over-expression Lysate

Sign In for Pricing
View Details
RIP3 (RIPK3) Rabbit Polyclonal Antibody
TA380940 100 µL

RIP3 (RIPK3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
B4GALT7 Human Gene Knockout Kit (CRISPR)
KN200258 1 Kit

B4GALT7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details