Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Chitin synthase export chaperone (CHS7)

This Recombinant Ashbya gossypii Chitin synthase export chaperone (CHS7) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Chitin synthase export chaperone

UniProt

Q754N9

Expression Region

1-339

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSKEAPMRAWLKMAGLAMSNKSWLSLGDFAGICAKTPLPMCFVVQTSSLPGGSVGATHY DRTHMNIGMVPRCYSRTVDIANTAIFQLGNAFVNILALCVILIISYNIRFKYTAIGRSEY GYFFQLCFMLICMTLVVDCGVSPPGTLAYPYLAALQIGLAGACSWALAVMGFLGFRLWED GTRKSMLIVRGVSMVGFLLGSLVSAITFTNWIQHHPDMKTNTTALFVVMYGLNGLALLMY SVCQLVVSIFVLSNFWMTGSTILGVIFITTGQVLMYTISYEICEGVKHYLDGLFIGSICN VFALMMIYKTWDISTDEDLEFSVSISVDGDIMYNSNLKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-188-5p miRNA Mimic
orb1876112-01 5 nmol

Mmu-miR-188-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-188-5p miRNA Mimic
orb1876112-02 10 nmol

Mmu-miR-188-5p miRNA Mimic

Sign In for Pricing
View Details
PPM1B (NM_177968) Human Tagged ORF Clone Lentiviral Particle
RC222782L3V 200 µL

PPM1B (NM_177968) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olfr1087 Protein Vector (Mouse) (pPB-C-His)
PV208134 500 ng

Olfr1087 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Purified anti-mouse CD355 (CRTAM)
GT04507 100 µg

Purified anti-mouse CD355 (CRTAM)

Sign In for Pricing
View Details
SURF4 Recombinant Protein Antigen
NBP2-49421PEP 0.1 mL

SURF4 Recombinant Protein Antigen

Sign In for Pricing
View Details