Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Chitin synthase export chaperone (CHS7)

This Recombinant Ashbya gossypii Chitin synthase export chaperone (CHS7) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Chitin synthase export chaperone

UniProt

Q754N9

Expression Region

1-339

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSKEAPMRAWLKMAGLAMSNKSWLSLGDFAGICAKTPLPMCFVVQTSSLPGGSVGATHY DRTHMNIGMVPRCYSRTVDIANTAIFQLGNAFVNILALCVILIISYNIRFKYTAIGRSEY GYFFQLCFMLICMTLVVDCGVSPPGTLAYPYLAALQIGLAGACSWALAVMGFLGFRLWED GTRKSMLIVRGVSMVGFLLGSLVSAITFTNWIQHHPDMKTNTTALFVVMYGLNGLALLMY SVCQLVVSIFVLSNFWMTGSTILGVIFITTGQVLMYTISYEICEGVKHYLDGLFIGSICN VFALMMIYKTWDISTDEDLEFSVSISVDGDIMYNSNLKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F4 Antibody
R33585-100UG 100 µg

E2F4 Antibody

Sign In for Pricing
View Details
AdmiRa-rno-miR-410-3p Virus
mr0815 250 µL

AdmiRa-rno-miR-410-3p Virus

Sign In for Pricing
View Details
Human Eomesodermin (EOMES) ELISA Kit
orb778060-01 48 Tests

Human Eomesodermin (EOMES) ELISA Kit

Sign In for Pricing
View Details
Human Eomesodermin (EOMES) ELISA Kit
orb778060-02 96 Tests

Human Eomesodermin (EOMES) ELISA Kit

Sign In for Pricing
View Details
PCSK7 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
36237124 3x 1.0µg DNA

PCSK7 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
5330439B14Rik (NM_177314) Mouse Tagged ORF Clone Lentiviral Particle
MR212974L3V 200 µL

5330439B14Rik (NM_177314) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details